PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.26326s0088.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family GeBP
Protein Properties Length: 319aa    MW: 35920.1 Da    PI: 5.1606
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.26326s0088.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57399.62.7e-3163154697
                DUF573   6 lwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskk 94 
                           +w+eeDe+++L+Gl+d++ak g + + ++dafy+f+ +si +k+s++q+++Kir+LK++f  +++k+ +g++p+f++++d+++f++s++
  Bostr.26326s0088.1.p  63 IWNEEDELAVLKGLVDYRAKSGFQTKINWDAFYRFLGGSIVAKFSNDQVLSKIRKLKRRFLVHWEKIIEGNDPKFTRSSDSEAFGFSMM 151
                           8**************************************************************************************** PP

                DUF573  95 iWg 97 
                           iWg
  Bostr.26326s0088.1.p 152 IWG 154
                           **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045046.1E-2363154IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MVSPKQLDFS SSGGADDTFS RQRSPRNPSS KRAASDAAEE AEEETKKKKK KKTKLGSPLS  60
IPIWNEEDEL AVLKGLVDYR AKSGFQTKIN WDAFYRFLGG SIVAKFSNDQ VLSKIRKLKR  120
RFLVHWEKII EGNDPKFTRS SDSEAFGFSM MIWGHNEADF AHDDDGIYKE MLKEHEEPVN  180
ENGAAKITDN GTARIAQQSE SGEEMFKEHE EVAGAEPFNE NGAAKTVENG STAGKESHDD  240
DDELCAVRDA FETLMSQGLS DYQKKLQLEK LMNIETGKRR ELSDEWKALC VEERRLIIEK  300
LRFSAKLAEA LDETKKPL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14551KKKKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010429565.11e-152PREDICTED: uncharacterized protein LOC104714031
TrEMBLR0G0S31e-147R0G0S3_9BRAS; Uncharacterized protein
STRINGAT2G25650.11e-133(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61171741
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25650.11e-135DNA-binding storekeeper protein-related transcriptional regulator